General Information

  • ID:  hor004342
  • Uniprot ID:  Q868G6
  • Protein name:  APMGFYGTR-amide
  • Gene name:  Atk
  • Organism:  Apis mellifera (Honeybee)
  • Family:  Tachykinin family
  • Source:  animal
  • Expression:  Strong expression was detected in the queen and forager heads, while weak and almost no significant expression was detected in the nurse and drone heads, respectively.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Apis (genus), Apini (tribe), Apinae (subfamily), Apidae (family), Apoidea (superfamily), Aculeata (infraorder), Apocrita (suborder), Hymenoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007268 chemical synaptic transmission; GO:0007610 behavior
  • GO CC:  GO:0005576 extracellular region; GO:0045202 synapse

Sequence Information

  • Sequence:  APMGFYGTR
  • Length:  9
  • Propeptide:  MIIHSIFLLMVSITLVIAEESDNVLFDKRAPTGHQEMQGKQNSASLNSENFGIFKRALMGFQGVRGKKNSIINDVKNELFPEDINKRAPMGFQGMRGKKASFDDEYYKRAPMGFQGMRGKKSLEEILDEIKKKTTRFQDSRSKDVYLIDYPEDYGKRVLSMDGYQNILDKKDELLGEWEKRAPMGFYGTRGKKIILDALEELDKRGVMDFQIGLQRKKDTTFDDYLDYAINPFDYEKRSTDFQDVESGSESFKRARMGFHGMRGKRDAAGIYGSNSSTVGTIFGYQDMRNRGNNFPVYQVEKRSPFRYLGARGKKNPRWEFRGKFVGVRGKKSSLQTVF
  • Signal peptide:  MIIHSIFLLMVSITLVIA
  • Modification:  T9 Arginine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Be active peptides which excite neurons, evoke behavioral responses, be potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q868G6-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004342_AF2.pdbhor004342_ESM.pdb

Physical Information

Mass: 114202 Formula: C45H66N12O12S
Absent amino acids: CDEHIKLNQSVW Common amino acids: G
pI: 9.35 Basic residues: 1
Polar residues: 4 Hydrophobic residues: 2
Hydrophobicity: -26.67 Boman Index: -861
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 11.11
Instability Index: 3926.67 Extinction Coefficient cystines: 1490
Absorbance 280nm: 186.25

Literature

  • PubMed ID:  12752663
  • Title:  Identification of a Tachykinin-Related Neuropeptide From the Honeybee Brain Using Direct MALDI-TOF MS and Its Gene Expression in Worker, Queen and Drone Heads.
  • PubMed ID:  17068263
  • Title:   From the Genome to the Proteome: Uncovering Peptides in the Apis Brain